SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000033667 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000033667
Domain Number 1 Region: 955-1082,1114-1315
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.24e-54
Family p120GAP domain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 18-182
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.25e-40
Family Calponin-homology domain, CH-domain 0.0000215
Further Details:      
 
Domain Number 3 Region: 1531-1626
Classification Level Classification E-value
Superfamily RGC domain-like 1.57e-29
Family RGC domain 0.00000949
Further Details:      
 
Domain Number 4 Region: 670-700
Classification Level Classification E-value
Superfamily WW domain 0.0000685
Family WW domain 0.002
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000033667
Domain Number - Region: 718-787
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00114
Family Motor proteins 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000033667
Sequence length 1628
Comment (Monodelphis domestica)
Sequence
SLVPDERLTAEEMDEQRRQNVAYQYLCRLEEAKRWMEACLKEELPSPVEMEESLRNGVLL
AKLGHFFAPDVVPFRKIYDLEQMRYKANGLHFRHTDNINFWLTAVSHIGLPKTFLPETTD
IYDKKNMPRVIYCIHALSLFLFRLGLAPQIHDLYGKVKFTEEELNNMTSELAKYGLQLPA
FSKIGGILASELSVDEASVHAAVLAINEAVERGVVEDTLAALKNPNAMLGNLREPLAAVY
QELLAQVKMEKVANSRNWYLQDNGDNHDIYDRYLTQAEIQGNINQVNVHGALETIDESLE
KQNSEALLEALSDPALGLRGVRRDFGDWYLEQLSLDREQKALLGLAELLEKEEIQAGVAA
ANAKGDQELAMLQAVGRINRAIRRGLAADTVKELMCPEAQLPEVYPFAASMYQQELTLIQ
RQQQGELAQEELFVALEMLSAVALINRYLEAGDAGGFWSSLSSPALGLADVDRENAQRYF
DALGRLRQEQSVAGAFLSWNDLQATVSQVNGQVQEESEQILAVSLINEALNQANPEKTLT
ALLLPSAGLDCVTLPVGPRYHHILTAAKKRKAQVTRDPGAALWLEEIRQGVAKANQETEA
ALKMALGVAAINQAIKEGKSAQTERVLHNPAVALYGVLTECASGYQRVLQASMARKKQAG
TGPSRLDKLFWVQHRMKDGAAFYFHLQTFQGTWERPSDCTLNTSHLSREEIQAAITSVTA
AHDRHRLWISNVGFVIQLQARMRGFLVRQEFAKHSHFLRTQLPAIIKIQAHWRGYRQRKT
YLERMRFLRANVASVTKIQAWVRMCIARKRYRERRRFFRKNIRSIVKIQAFFRARRARDD
YRMLVRDRHPPLAVVRRFAHLLDQRQQDFWEEAELLRLQEDVVRKIRSNQQLEQDLNLMD
IKIGLLVKNRITLQEVVLHSKKLTKKNKEHLSDMMALDRQKGLKSLSKEKRQKLEAYQHL
FYLLQTQPIYLAKLIFQMPQNKTTKFMESVIFTLYNYASNRREAYLLLQLFKTALQEEIK
SKVEQPQDMVTGSPTVIKLVVSFYRNGRGQSALREILGGVIQGVLEDRTLSVYTDPIHLY
KTWINQTEAQTGQRSHLPYDVTPEQALSHPEVQRRMDISVRSLLTVTEKFLTAILSSVDQ
IPYGMRYVAKVLKTSLAEKFPRATEGEICKVVGNLLYYRFLNPAVVAPDAFDIVALAAGG
ALSSSQRTSWDPLGRILVERIFLGKQLESSPVPTLHPSLPLRGRKFICKACRVPEPEERF
AMDEYSDMVALAKPVVYITVGELVNTHKLLLEHQDSIAPDHRDPLHELLEDLGELPTVPA
LIGQNLASDGNLDMSQLEVSLTLTSKFEGLEADPEDTNTRSLLLRTKQMLVDIIQFQAGD
SLQDILSFLPSGEQEAAHHILMSRRQAFEAQTPEPLKRRRSLTAQSLLSIREKQRRVLKN
LRHLESLGLVTSADGYQGLVDEMAQDIRNQRRHRQRRKAELVKLRATFQGLQAKTAFYEE
QGDYYNQYIRTCLDSLAHSNKSDRKGKKQPSLHYTAAQLWEKGVLVEIEDLPVTHFRNVI
FDIIPGEEAGKFEVKAKFMGVDMERFQVHYQDLLQLQYEGVAVMKLFNKAKVNVNLLIFL
LNKKLYLK
Download sequence
Identical sequences 13616.ENSMODP00000033667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]