SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000035297 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000035297
Domain Number 1 Region: 854-1161
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.21e-103
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000948
Further Details:      
 
Domain Number 2 Region: 1121-1403
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-75
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000212
Further Details:      
 
Domain Number 3 Region: 319-513
Classification Level Classification E-value
Superfamily Fibronectin type III 8.64e-29
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 4 Region: 1-119
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-27
Family MAM domain 0.000000697
Further Details:      
 
Domain Number 5 Region: 217-349
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000535
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 6 Region: 126-224
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000044
Family I set domains 0.0000346
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000035297
Sequence length 1423
Comment (Monodelphis domestica)
Sequence
TGSFMLVNTSGRPELQRTHLLLPQLKENDTHCIDFHYFVSSKSHSLPGLLNVYVKVNNGP
LGNPIWNISGAPTGTWNRAELAISTFWPNFYQVIFEVVTSGHYGYLAIDEVKVLGHPCTK
TPHFLRIQNVEVNAGQFATFQCSAIGRTVAGDRLWLQGIDVRDAPLKEIKVTSPRRFIAS
FSVVNTTKQDAGNYRCMIRTEGGVGISNYAELVVKEPPVPIAPPQLASVGATYLWIQLNA
NSINGDGPIIGREVEYCTASGSWNDRQPVDSTSYKIGHLDPDTEYEISVLLTRPGEGGTG
SPGPALRTRTKCADPMRGPRKLEVVEIKSRQITIRWEPFGYNVTRCHSYNLTVHYCYQVG
GQEQVREEVSWDTDNSHPQHTITNLSPYTNVSVKLILMNPEGRKESQELIVQTDEDLPSS
VPIESIQGSTFEEKIFLQWREPAQTYGVITFYEITYKAVSSFDPEIDLSNQSGRVSKLGN
ETHFLFFGLYPGTTYSFTIRASTAKGFGPPATNQFTTKISAPSMPAYELETPLNQTDNTV
TVLLKPAQSRGAPVSVYQIVVEEESPRRTKKTTEILKCYPVPIHFQNASILNSPYYFAAE
FPANSLQAAQPFTIGDNRTYNGYWNSPLLPHKSYRIYFQAASRANGETKIDCVRVATKAA
ILVTQLTTPYIRIAPAAGDDQLTGAATPKPAPEPEKQTDHTVKIAGVIAGILLFVIIFLG
VVLVMKKRKLAKKRKETMSSTRQEMTVMVNSMDKSYAEQGTNCDEAFSFMDTHNLNGRSV
SSPSSFTMKTNTLSTTVPNSYYPDPFVPTAILDETHTMASDTSSLVQSHTYKKRENADVP
YQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYESFFEGQSAPWDSAKKDENRMKNRYG
NIIAYDHSRVRLQTLEGDTNSDYINGNYIDGYHRPNHYIATQGPMQETIYDFWRMVWHEN
TASIIMVTNLVEVGRVKCCKYWPDDTEIYKDIKVTLIETELLAEYVIRTFAVEKRGVHEI
REIRQFHFTGWPDHGVPYHATGLLGFVRQVKSKSPPNAGPLVVHCSAGAGRTGCFIVIDI
MLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAILEACLCGDTSVPASQVRSL
YYDMNKLDPQTNSSQIKEEFRTLNMVTPTLRVEDCSIALLPRNHEKNRCMDILPPDRCLP
FLITIDGESSNYINAALMDSYKQPSAFIVTQHPLPNTVKDFWRLVLDYHCTSVVMLNDVD
PAQLCPQYWPENGVHRHGPIQVEFVSADLEEDIISRIFRIYNASRPQDGYRMVQQFQFLG
WPMYRDTPVSKRSFLKLIRQVEKWQEEYNGGEGRTVVHCLNGGGRSGTFCAISIVCEMLR
HRRAVDVFHAVKTLRNNKPNMVDLLLRNKELCAIIFLEYFVKS
Download sequence
Identical sequences 13616.ENSMODP00000035297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]