SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000035538 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000035538
Domain Number 1 Region: 3073-3249
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.18e-35
Family Laminin G-like module 0.00091
Further Details:      
 
Domain Number 2 Region: 2903-3067
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-26
Family Laminin G-like module 0.0051
Further Details:      
 
Domain Number 3 Region: 2503-2656
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.77e-20
Family Laminin G-like module 0.005
Further Details:      
 
Domain Number 4 Region: 2672-2818
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000109
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 5 Region: 2300-2496
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000376
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number 6 Region: 1267-1318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000167
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 7 Region: 441-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000053
Family Laminin-type module 0.0064
Further Details:      
 
Domain Number 8 Region: 1599-1641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000137
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 9 Region: 1651-1701
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000153
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 10 Region: 1177-1225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000254
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 11 Region: 260-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000137
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 12 Region: 203-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000046
Family Laminin-type module 0.048
Further Details:      
 
Domain Number 13 Region: 396-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 14 Region: 536-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 15 Region: 1316-1364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000128
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 16 Region: 589-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000046
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 17 Region: 330-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000558
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000035538
Domain Number - Region: 1741-1867
Classification Level Classification E-value
Superfamily Tropomyosin 0.000105
Family Tropomyosin 0.0062
Further Details:      
 
Domain Number - Region: 490-533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000307
Family Laminin-type module 0.011
Further Details:      
 
Domain Number - Region: 1562-1601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000949
Family Laminin-type module 0.046
Further Details:      
 
Domain Number - Region: 1229-1264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00162
Family Laminin-type module 0.034
Further Details:      
 
Domain Number - Region: 2180-2290
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00445
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.034
Further Details:      
 
Domain Number - Region: 1930-2045
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0523
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000035538
Sequence length 3250
Comment (Monodelphis domestica)
Sequence
FQGQFCDYCNSGDPNKAHPVTNAIDGTERWWQSPPLSLGLQYNKVNVTLDLGQLFHVAYV
LIKFANSPRPDLWVLERSVDSGRTYLPWQFFAHSKIDCWEHFGTEANMPIIEDDDVICTT
EYSRIVPLENGEVVVSLVNGRPGAKNFTFSPTLREFTKATNIRLRFLRTNTLLGHLISKA
QRDPTVTRRYYYSIKDISIGGRCVCNGHAEVCRAQGPENLFQCECQHNTCGESCGHCCAG
YNQKQWQPATAEQTNECEACNCHGHATDCYYDPDIERLKGSLNIHGVYEGGGVCINCQHN
TAGVNCERCLQGYYRPYNVPVEAPHGCMPCSCNPEYTDGCEQGTGRCICKPNFRGENCEH
CAKGYYNFPFCLSIPIYPVFTPRPEASTTPSGITGCECNSVGVTSEICDFHGKCLCRFGV
GGPKCDSCSSGFYSFPACQACQCSPLGSYQTTCDPGTGQCECRPGITGRLCDQCLSGAYD
FPHCQGSSSECNPLGTMDSSSGFCQCQLYVEGPTCSICKPLYWNLAGENPDGCSECQCDV
TGTLSGVGECEQREGECYCKPHVCGDSCNACEDGYYALEDSNYFGCQGCHCDVGGSISSV
CDDLSGACQCREHIMGKSCQQPEINYYFPDLHHMKFEIEDGTTPNGRGVRFGFDPMEFPD
FSWRGYAQMTSVQNEVRVTLNVEKTRQYLFRAILRYINPGIETVFGHITIYRMNNIFPLT
GAVQSKEIVFLPSKEPSFVTIPGNGFADPFSLTPGMWIVNIKAEGILLDYLVLLPSDYYE
ASILQLPVTEPCAYWGPIGENCLLYQHLPVTRFACVSACEAERFLLNGMPRTLGTRRPTP
EHPVMAEISGREIELHLTLSIPQVDHYVIVIEYANEDSQLYVADILINSPSSSSAGRMNI
YSCKYSFLCRSFVVDDLNRVAVYELLADARIQLKAHLAHFLLHQICIIPVGEFSTEYVKP
SVHCIASYGQFVNQSSSCILLAHETPPTALVLDALNGGMLPFVPQDPLPSASGFRGVILK
SPQNQVTLRGRVPHPGQYVFIVHFCQPDYPTFPAQVVVEGGQQWSGSFSASFCPQVFGCR
NLVIAESQTNLDMREPEFSVTVKVPDGKSLMLVQVLVVPAESYGYHMLQKKSVDKSFDFI
NNCGGNSFYIDPLTSSGFCKDSAHSLVAFYNNGALPCDCHVMGAINPTCHPEGGQCQCRT
NVIGRQCTRCQTGYYGFPFCKLCHCGRRLCDEMTGKCICPPRTVKPQCEVCEKQSFSYHP
LVGCKVCNCSRIGAINATAPECDKNNGQCRCKPRITGRQCDRCTSGFYRFPECIPCNCNR
DGTEPGVCDPWTGTCLCKENVEGAECNICQKGSFYLDPSNPKGCTSCFCFGISDLCHSTN
KRRAKFVDMIGWHLETADQMVIPVTFNPGSNSVVADIQELPSSVHSVYWIAPSSYLGDKV
SSYGGFLTYQVKSFGLPSEGMMLLEKRPDVQLSGQQMTIVYMDPNNPLPDRRYYGRVQLV
EGNFRHVSSNNQVSREELMMVLSRLDGLHIRGLYFTETQRLTLGEVGLEEVTNTGSGSIA
YNVEICSCPPDYAGDSCQGCSPGYYRDNKGFYTGRCVPCNCNGHSNRCQDGSGTCINCQH
NTAGTNCERCKEGYYGDALHGSCRVCPCPHTNSFATGCVVNGVNVKCSCKPGYVGAQCER
CAPGYFGNPQKFGGSCQPCNCNNNGQLTSCDPLTGDCIIQEPKDGGPEECDDCDSCVTTL
LKDLGAMNDELRLIKSQLQSTSANAATLEQMKHLETQTKDLRNHLLSYQSAISSRVSKID
ALEKDLNSLNQDFETLQEKVQINSRKAQTLYNSVSQTSQSAKQLDTRIQSVIRDVHVLLK
QISGTDGEGHTLPSGDLSRKLAEAERMMKEMRSRDFREQLRKAEAEKREAQLLLNRIQSS
LKNHQAENHELVKTIRDSLNEYEVKISDLRKALQEATLQTKLANGLNQANDRALEDIKRR
INEMSSLQSEFTKHLTTAESSLRQTNSVLQLMKKSQEEYETLASSLNEVRQELSDKVKDL
SRSSSKESLVVEAEKHAQSLQNLAKQLEEIKRNTSGDELVRCAVDAAMAYENIINAVKAA
EDAANKAVGASDSALQTVVKGDLPRKAKTLSSNSDKLLREAKTTQTRLQQDINPALDSLR
DTLDVVTAKKGLIQTDLATLQDDLRGINRDDIDRMTNNAKSLIRNANDVTSSVLDGLTPI
QTHVERLQETYGSARSEDFNEALSDANNSVKKLTSKIPDLLSKIESINQQLLPLGNISDN
VDRIRELIQQARDAANKVAVPMRFNGKSGVEVRLPNDLEDLKGYTSLSLFLQRPESREDG
GEDEDMFVMYLGNKDTSKDYIGMAVRDGKLVCVYNLGDREAETQMDPILTKSLTQEAIMD
RVKFQRIFQFAKLSFFKEATSNKPKPPDFYDMDSGSGDVLLNLDPENVVFYVGGYPPNFK
LPRVLKYPPYKGCIELDDLNENVLSLYNFKKTFNLNTTEVEPCRRNKEESDKNYFEGTGY
ARVPTQPSTPFPNFQQTIQTTVDEGLLFFAEHEDFFISLIMEKGYPVLRYKLNSEPPQEK
RNRVPMNDGTDQMITIRMGKVQKVLRITVNQSVIEVQGAQIFNFNTYYLGGIPISLREKF
NITTPAFRGCMKNLKKTIGVIRLNDTVGVTKKCSEDWKLVRTASLSRDGQLSFIDVGLPD
PNYFQSSFGFQTFQPNGLLLRHQIGTNNLQIALEDGHIELSSREQGTILKSPQTYMDGLL
HYVSIIKDDAGLRLLIDDKSLKDNQRLRIFPDSQQSLRFGGSDFEGCITNVFFQRLTQNP
EVLNLVTHTRREKEKVSLGVCNLNKPPFLMLLKSSAKLSTSRTFNIDRLQQDMRPASLMK
KKVQTVAQHCLEWSQSQASKGAYQFGDSPTSHLSYTLPEEILKDRSDFAVDIQTTSTAPG
LVFFVGSKSSFMVLYFSKGRIIFLLKAEGKKLRMKTKEKLNDGKWHTVMFGHKGSKVHFI
IDGLKIQEGSLAGNSFFTVTPPIYLGASPQVKLKSLPKSSFIGCLRNFQLDGKALDTPSQ
NFGVTPCLGGPLEKGMYFSQDGGHISFDNSWMVGKEFKIIFSIRPRSLTGLLMHTGSQPG
KHLSVYMEEGKVTASVGSGAGEMLTSVTPQQSLCDGQWHSVAVTLKQNLLQLDLDTDSSS
ETGQLPSLPGSNQQPLYLGGIPANLTTLRLPVQNPFFGCLKKVTINNIAVPVTKASGVQG
AVSPNGCPVH
Download sequence
Identical sequences 13616.ENSMODP00000035538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]