SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000036367 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000036367
Domain Number 1 Region: 89-158
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 6.93e-23
Family Skp1 dimerisation domain-like 0.0000378
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily POZ domain 1.81e-20
Family BTB/POZ domain 0.0000767
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000036367
Sequence length 159
Comment (Monodelphis domestica)
Sequence
MPSIKLQSSDGEIFEVDVDIAKQSVNIKTMLVDLGMDNKGDDGPVPLSNVNAVILKKVIQ
WRTHHKDDPPPPPEDDENKEKQTDDIPVGDQEFLKVDQGTLFEFILDANYLDIKSLLDFT
CKNVANMIKRKTPEEIHKTFSMRNDFTEEEEAQVCKENQ
Download sequence
Identical sequences F6UTJ7
13616.ENSMODP00000036367 ENSMODP00000036367 ENSMODP00000036367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]