SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000036372 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000036372
Domain Number 1 Region: 273-451
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-41
Family SPRY domain 0.00029
Further Details:      
 
Domain Number 2 Region: 10-67
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-17
Family RING finger domain, C3HC4 0.0097
Further Details:      
 
Domain Number 3 Region: 94-155
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.59e-16
Family B-box zinc-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000036372
Sequence length 452
Comment (Monodelphis domestica)
Sequence
APKRKMAADWEIVQNLQNEITCGICRNYFSQPVTIDCGHSFCRECLSRSWSIRPFSCPEC
RQVPQIRQFPKINSNLEKLTDISLQLSPLNLQRAIERNQCPIHKKAFKVFCEEDQTSLCV
LCFQMPEHRAHTLTPAEEAAQNYREKFREILSHLEKDFEEAKKYLSQEKEMEEGPDWNEM
IMAEYCKLHSLLLDEEVQYLERLKEEQRTRKFRLSQHIGTIQEIMIEIQESSYNPNAELL
KDIRELLGRGESVLSQRSNVIIPELREYSFPAMIDCLNKFRVDIRVDPKSSSSYVTVSED
QKTMRAEEGWQVDYSHAEDSTHHYVFADQAFSSGSHYWEVDVTQVSQWALGIYSPTLRKE
NSLFLLSCVKKENNYYFQTYPESLNHQVKDPVPRIGVYLDYSTGILLFYNVLQSSPIYRF
YPLLFIKPVIPVFSPGPPLPGTKANLMTICSV
Download sequence
Identical sequences F6UCL0
13616.ENSMODP00000036372 ENSMODP00000036372 ENSMODP00000036372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]