SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000036797 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000036797
Domain Number 1 Region: 37-171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.18e-35
Family Galectin (animal S-lectin) 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000036797
Sequence length 172
Comment (Monodelphis domestica)
Sequence
MAGSVAQREALEKLEDRHLNNFLGSTFHAEVYLPRLIIPFCGPIKGGMRPGKKILVMGIV
DLNPESFKISLTCGDSEDPPADVAIELKAVFTDKQLIRNSCISGERGEEQSAIPYFPFIP
DQPFRVEILCEHPGFRVIVDGRQLFDFYHRIESLSTIDTIKINGDLQITKLG
Download sequence
Identical sequences F6R5S3
ENSMODP00000036797 ENSMODP00000036797 13616.ENSMODP00000036797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]