SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000037883 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000037883
Domain Number 1 Region: 1-52
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000000000491
Family BCR-homology GTPase activation domain (BH-domain) 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000037883
Sequence length 53
Comment (Monodelphis domestica)
Sequence
VCEHSRENLMSPSNMGVIFGPTLMRAQEDTVAAMMNIKFQNIVVEILIEHFDK
Download sequence
Identical sequences F7D142
13616.ENSMODP00000037883 ENSMODP00000037883 ENSMODP00000037883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]