SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 138119.DSY1104 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  138119.DSY1104
Domain Number 1 Region: 11-110
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.08e-22
Family PadR-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 138119.DSY1104
Sequence length 115
Comment (Desulfitobacterium hafniense Y51)
Sequence
MSANEQMQNFITELRRGSLTLAVLGCLKQPHYGYALLQTMQEKQIDVEANTLYPLLRRLE
NQGLLVSDWDTSESRPRKYYTVNEKGEMVYRELMTEWKKLQSNIESICGEDKCNG
Download sequence
Identical sequences A0A098AZH2 B8FSL4 G9XRG2 Q24YJ9
gi|89893850|ref|YP_517337.1| 138119.DSY1104 272564.Dhaf_2191 gi|219668226|ref|YP_002458661.1| WP_005814298.1.13927 WP_005814298.1.73069 WP_005814298.1.80252 WP_005814298.1.94859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]