SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 138119.DSY1997 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  138119.DSY1997
Domain Number 1 Region: 2-129
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-24
Family cAMP-binding domain 0.015
Further Details:      
 
Domain Number 2 Region: 134-211
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.06e-20
Family CAP C-terminal domain-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 138119.DSY1997
Sequence length 212
Comment (Desulfitobacterium hafniense Y51)
Sequence
MSKEEESCILQFGTIMRYHRGQVIFSESDTADRIYYIKEGYVRIFRVTPYGKKVTVGSIR
SPGQLMGLAETLYRGDRTCFASAINEVTLVVVRNPQFMDLLVKYPAIAIKASITLAIRMR
EAEQIIEEIACFQVSGRLAMFLVKMAKRMGVETPRGTKINFRLTHEEIAYMIGTTRQNVT
SLLNVFKEENSIAIEDKELYILDFDKLNNWIV
Download sequence
Identical sequences Q24W06
gi|89894743|ref|YP_518230.1| 138119.DSY1997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]