SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 138119.DSY2427 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  138119.DSY2427
Domain Number 1 Region: 2-136
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.81e-38
Family Transcriptional regulator Rrf2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 138119.DSY2427
Sequence length 146
Comment (Desulfitobacterium hafniense Y51)
Sequence
MKLSTKGRYGLTAMVDLALNSGEGPISLKSIADRQGLSEHYLEQLISGLRKAGLVKSIRG
AQGGYVLGKKAEKIRIGDIIRVLEGPIAPVECEANGDPECCQKSDYCVTRSIREKVRDPI
EDVLDSISLADLVRDPQTMCTIADPG
Download sequence
Identical sequences A0A098B0V8 A0A1M7U775 B8FQR2 Q24US6
WP_011460328.1.13927 WP_011460328.1.73069 WP_011460328.1.80252 WP_011460328.1.82035 WP_011460328.1.85503 WP_011460328.1.88067 WP_011460328.1.94859 138119.DSY2427 272564.Dhaf_3582 gi|89895173|ref|YP_518660.1| gi|219669600|ref|YP_002460035.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]