SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 138119.DSY2928 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  138119.DSY2928
Domain Number 1 Region: 20-201
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000000000000133
Family HD domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 138119.DSY2928
Sequence length 223
Comment (Desulfitobacterium hafniense Y51)
Sequence
MYGNEIRQLLTDLAWVDDISYYHSLRVGYLMSRFAETDMGKQFVKQAWVTRNEFVAAGLL
HDIAKLRWPIEILLSDERLKDLEREELLRVWGYMIEHPLGSEEIVMDYYKRTGNRFWERI
AKGVVSHHENYSGDGYPYRLKGTEIPLLARGVRVFDHYVRDVEVRRHKNKSQDPGAVIKE
MHSILGVHFDPYWGEKILDYLEATPAFPANLDQWLDEELKKNF
Download sequence
Identical sequences A0A098B2H8 Q24TC5
138119.DSY2928 gi|89895674|ref|YP_519161.1| WP_011460711.1.80252 WP_011460711.1.88067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]