SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 138119.DSY4215 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  138119.DSY4215
Domain Number - Region: 9-149
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.000814
Family YiiX-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 138119.DSY4215
Sequence length 191
Comment (Desulfitobacterium hafniense Y51)
Sequence
MFRTLYVYLVFSKTGTWLSRVLTLFTGEKYVHTSISLDHDLKTMYSFGRVTPNNPFSAGF
IRENFNKGVFLKKSNCECIVYRIKINEIQHAMLINELSRFIAADQFLRYNFLGLFTAAMK
IPMRRENHYFCSQFVSELLMKINLLQNPFPPELTKPMDLYHIEGKEEIYQGFTWQFGAAS
LGSANRGCVAK
Download sequence
Identical sequences Q24PN8
138119.DSY4215 gi|89896961|ref|YP_520448.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]