SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 146891.A9601_01011 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  146891.A9601_01011
Domain Number - Region: 31-62
Classification Level Classification E-value
Superfamily TM1646-like 0.0196
Family TM1646-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 146891.A9601_01011
Sequence length 76
Comment (Prochlorococcus marinus AS9601)
Sequence
MSSNAEKLYKLIANDSKKKQSLFMTALTNPKKALDKICDIGNELNISVTKEEVIEYLSTI
DDEATKMWLIKARGGL
Download sequence
Identical sequences A0A0A2ALH4 A2BNM8
WP_011817578.1.19096 WP_011817578.1.36019 WP_011817578.1.51421 WP_011817578.1.60321 WP_011817578.1.61476 WP_011817578.1.6215 WP_011817578.1.74777 WP_011817578.1.75422 WP_011817578.1.77012 WP_011817578.1.786 WP_011817578.1.95287 MES00000257777 146891.A9601_01011 gi|123967638|ref|YP_001008496.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]