SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4QQ25 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4QQ25
Domain Number 1 Region: 17-82
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000903
Family Tetramerization domain of potassium channels 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.A4QQ25
Sequence length 228
Comment (Magnaporthe grisea)
Sequence
MGAEVLALQEEELRKHDIVQIQVGERLYTTTRGTLTSESVYFRHLFADPETLDKKLFLDA
DPGMFEHVLRYLRHGTMPMFYDRAKGHGFARYRTLAVVSEFLGIAKLTSWLVEGRYVDLL
RIRRSVEVHREVDAENLTSLAGGETRAGLDKTILHPRWAIKRVWVCPSSTPGHDQNPAVC
SNNCPGQGGDGERWCEELVLDVLVVKQELVLVSSWWTMLGGETNEDCF
Download sequence
Identical sequences G4NFV4 L7HPI2 L7JP13
MGG_08702T0 XP_003719278.1.18062 148305.A4QQ25

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]