SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4QTA1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4QTA1
Domain Number 1 Region: 150-244
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.25e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.A4QTA1
Sequence length 245
Comment (Magnaporthe grisea)
Sequence
MPAPTAVKPTAAIEDGAAVAPVADNGSMAVEADQAEEFMLDTTDQTLPAASDIAAPTEEN
TEMAVDEESRPKFSAAKDEGPSVMKETRKVPIPPHRMTPLKKDWTQIYEALVEHLKLQYG
SNMLPTEDFVKAYTLGFEVQDAIALIRVPELYIQTFEIKDVKSLTGDHLARGVGRIAGKD
GKTKFAIENASRTRIVLADSKIHILGSFRNVRMAQESIVDLILGKPPSKVYGNLRTISAR
QKERF
Download sequence
Identical sequences 148305.A4QTA1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]