SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4QTS8 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4QTS8
Domain Number 1 Region: 90-165
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 5.76e-32
Family Skp1 dimerisation domain-like 0.0000298
Further Details:      
 
Domain Number 2 Region: 8-74
Classification Level Classification E-value
Superfamily POZ domain 1.15e-19
Family BTB/POZ domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.A4QTS8
Sequence length 168
Comment (Magnaporthe grisea)
Sequence
MSEGQLQKVNLQSNDGQSIEVDRAVACRSRLIKDLIGDLGEEMVASTPIPIPNVSEAVLR
KVLEWCEHHRNDPVQTSDEDSESRKKTTDIDEWDQKFMQVDQEMLFEIILASNYLDIKPL
LDVGCKTVANMIKGKSPEEIRKTFNITNDFTPEEEEQIRRENEWAEDR
Download sequence
Identical sequences G4N3J5 L7IPU7 L7JH78
MGG_04978T0 148305.A4QTS8 XP_003712477.1.18062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]