SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4QUW0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4QUW0
Domain Number 1 Region: 19-281
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-45
Family Glycosyl hydrolases family 16 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4QUW0
Sequence length 291
Comment (Magnaporthe grisea)
Sequence
MRVLSLGVLVSLLSSSVSAWNAPTYSDLRLVWQDAFAGTLGSAPDAGRWNYITNINVNNE
LQRYTTDSRNRQLSGGETLQIVPWHTNNEWTSGRIESKYTFTPAYGTVTVGEARIRFGDN
PISQKKGIWPAFWLLGDSLRSGTPWPQCGEIDILETVNGALTGYGTVHCDVYPGGICNEP
SGLAGTTGIPDQGWHTWRVQFDRRAGSWRDETITWFLDGQQFSQLNGARIGNEGVWNSLC
HSPLYFILNLAVGGTFPGNPDGNTLDGYGSMMEVGYVAHYDFPTAQYPSII
Download sequence
Identical sequences 148305.A4QUW0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]