SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4QUZ0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4QUZ0
Domain Number 1 Region: 48-168
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000785
Family BTB/POZ domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4QUZ0
Sequence length 209
Comment (Magnaporthe grisea)
Sequence
MFLSDYYANEAFPELFPSAEENPTETQTAGSETELKMTQESKGSWLCHRLYSHADYSDFM
ISGDGKDYRVHKAVVCPQSEYFSTACRAFKEAETNRIDLQEDDPQAVQLMVCFFYHEDYG
VTQNALTKEDPREILGQPIVPQDSSQLDTHIKVHVLADKYCLDKLKALSQTKFRDAAAFA
KMPRPQYFESNGLIRINTIAPKMRDLMAR
Download sequence
Identical sequences G4MQE9
XP_003710747.1.18062 148305.A4QUZ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]