SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4QX79 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4QX79
Domain Number 1 Region: 41-421
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 3.77e-61
Family Glycosyl hydrolases family 32 N-terminal domain 0.00028
Further Details:      
 
Domain Number 2 Region: 474-610
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.7e-18
Family Glycosyl hydrolases family 32 C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4QX79
Sequence length 659
Comment (Magnaporthe grisea)
Sequence
MKFTFVSSALLALVSSAAAQAPPVPQPLTADWLLNKAGNNSLFTRWRPRSHFIAPSGWMN
DPCGAVHDPATDTYHLHYQFHPNHVGWGNVSWGHAVSKDLFHWTDVGGWENDTAVSLAAS
HYKTSPLSVFTGTTQPVNLQGEHDGTLLTFLTGIHRLPTNWKIHYQNGTEVQALFTSKDA
GLTWQEQGIAIPGPPEGWNVTGFRDPSFFPNPDLDAMRNVSEPHYYAVLGSGLKGPDVPA
ELPGAARPGYIGPRMPLYTAPASNLTDWKFLGALWEPAANSSLGNPDVTGSFGYNFEVSG
LFELKANGSDDGAFFVTTGAEGGNTTRHVREQWAVWARGNLSPRANGSIELKPSSGGAVD
WGLSYAQASFVDSRKGNQERRVMWGWANEDIEDDVELAVARTMGYAGAITLPTELFLMET
RGVQKHDYVDGNEWIPDNGAFTAQTLGIRPLPDVIEKLKTGAALNTFDVATVTAGTPKKV
SENVGDSYVLTATLAAPNGTAGIVIAQSPDNSEYTSIVYDAAAKTIGVRRDHSSSLVGIF
SNYTHEGHFAPYKTAGGAAEDIKFTIVYDKSLLEVFVNDRFALTSRIYPVRTDSTALSFF
TGAFGSDKKTDATETTVWKDVKLWMGLAKAWTERPDDSSSPLHWDSAEQTNNYTWWNGW
Download sequence
Identical sequences G4N0X0 L7J6Z1
MGG_05785T0 148305.A4QX79 XP_003712155.1.18062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]