SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4R798 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4R798
Domain Number 1 Region: 33-174,207-333
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.63e-21
Family Glycosyl hydrolases family 16 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4R798
Sequence length 334
Comment (Magnaporthe grisea)
Sequence
MASYKSFFMLLSAVTSASAQQYKLVKSYNRSTNFFDFFNVRDRAFFNNLGYATGDPTSGF
VDYATRQEALSSGLMAYRGNQMYIGVDSTNTVPVNGRGRKSVRLESRETFNGGLLLADIA
HMPGNACGVWPALWAYNMNENPISEIDFLEGNGWTGQAENTVSLHTCGRCAFPNLKGPEL
RRDCDLKGCEGTPSNPAGCGVNGGKGSFGTGFNNGGGGIYALLLDTTGIRVWFLPRNKIT
SDITSGKPNPSLWGTPQADFRSSSSCNVGKTFKDLTIIVNTSFCGAIMYDYKAQMEGYPQ
CGSAPGGSCNAYVGANPQAYKESYWLFNSIKIYK
Download sequence
Identical sequences G4N982 L7HYN3 L7JBX9
148305.A4R798 XP_003716645.1.18062 MGG_03315T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]