SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4R8H5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4R8H5
Domain Number 1 Region: 119-365
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-73
Family Calponin-homology domain, CH-domain 0.0000351
Further Details:      
 
Domain Number 2 Region: 380-503
Classification Level Classification E-value
Superfamily Spectrin repeat 5.9e-30
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 3 Region: 605-760
Classification Level Classification E-value
Superfamily EF-hand 2.36e-18
Family Calmodulin-like 0.0045
Further Details:      
 
Domain Number 4 Region: 506-611
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000216
Family Spectrin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 148305.A4R8H5
Sequence length 778
Comment (Magnaporthe grisea)
Sequence
MDHQYPHDAGSVPSNREDWPLFTNENSYHPGGHTDNSLNRPPSLSLSSTTSSYDFSDKDS
VFDSQRASFISTSSSIDSCSIACGSPLPRSRSNAKQLALARLQRSGSNPVGLSSKKADSP
SRKRFYSSGSAQEALAATEPAGGGLTKMEEDWVSTQQKTFQKWANSKLAERSLETKNLVE
DLKDGASESLGRFASKPKLPVQQYENANTALGFIQSRGIRLTNCGAEDIVKGNRKIVLGL
IWTLILRFTISDINEEGLTAKEGLLLWCQRKTACYEECDVRDFSASWNDGLAFCALLDIH
RPDLIDYDALDKTDHKGNMQMAFDIAHKEIGIPKLLDVEDVCDVAKPDERSLMTYIAYWF
HAFSQMEKVENAGRRVEKFVNNMQGAWEMQSAYERRMAALLQAIRAQVESWQQAKFEGSY
TDAKAQATDFASYKRGKKREWVAEKSELATLLGNIKTKLGTYRLRPYEPPAELRLDVLDG
EWANLAAAEMKRGQLINETIRDIKNALRKSFADKANDFALALNTIQLAISGLEGDVEDQL
HHVRKLSENLPPLDEYLKTIGAVDAKCQEANIEENDFTTYTYDELCYELGLVKSSVAKKL
AFLDNQMVARNMTNLTPIQLEEFESVFRHFDRDDSNSLAELEFGAALASLGVVFSEGEMH
EYFVETAKGRDRITFEQFIRFMVEVTEDQNTAEQVYQSFREVADGKPYVTEMDLRHSLVP
DEVIDKLIEIIPAHNGPDTAQDRGMPQYDYIAFMDKFIGSDAAANGCKSPTKVTVNGH
Download sequence
Identical sequences 148305.A4R8H5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]