SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4RBN3 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4RBN3
Domain Number 1 Region: 67-151
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.3e-21
Family Cold shock DNA-binding domain-like 0.00049
Further Details:      
 
Domain Number 2 Region: 175-262
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000169
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Weak hits

Sequence:  148305.A4RBN3
Domain Number - Region: 7-55
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0544
Family ECR1 N-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RBN3
Sequence length 264
Comment (Magnaporthe grisea)
Sequence
MAAATERPFVLPGEAIDPSLIPTHPKRPLRLGPGLRHIPPDEIVPTVAGKLVVNPAKPSL
SLDYNGGRYVPEPNDLVIGQVHHSSADFHFVTLAPHTTNALLPVLAFEGATRKTRPVLPA
GSLVYARVASASRHMDAELECFSQTTGKADGLGPLNPPAAAAPGAGAVAAAAPTGTVFNV
SLGMARRLLMPQAERDAGLVVLDALAAEGLAFETAVGRNGKVWVASESVPTLVLVGRALA
EVDEKGLDMDAQRRLVKKLVREMS
Download sequence
Identical sequences G5EH77 L7IGP5 L7JJV2
XP_003720894.1.18062 MGG_02843T0 148305.A4RBN3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]