SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4RCN5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4RCN5
Domain Number 1 Region: 24-418
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-155
Family Glycosyl hydrolase family 7 catalytic core 0.000000000473
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RCN5
Sequence length 424
Comment (Magnaporthe grisea)
Sequence
MAKFSALCSLALLGLATAQKPVGTETHEKLTTFRCTVAGGCVEKTNYIVLDSITGHRIYQ
PAAETLDCGARGAAPNVTACPTKEACAENCAMEGRTDYGSQGVSTDGASLRLQILHDGKK
VAPRVYLLDETEAKYEMLRLTGNEFAFEVTMDKLPCGMNSALYLSEMEEDGGKSELNPGG
APWGTGYCDAQCYVTPFINGEGNIKGNGACCAEMDIWEANSRATHIAPHPCSKPGLYLCE
GDECGSTGVCDKSGCAWNPNRIAQPHYYGNNDTFKVDTLKPMTVVTQFPTDASGKLAAIR
RLYVQGGVVIKAETVHKAGLPEVDALTDPFCEAFGSQRYMALGATGGMGDALARGMVLVM
SIWWDETGGNMQWLDGIASGSGPCNATEGAPANIPLVEPNPEVTFSNLKWGEIGSTFQGG
ARRL
Download sequence
Identical sequences G4NK46
XP_003721274.1.18062 148305.A4RCN5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]