SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4RD34 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4RD34
Domain Number 1 Region: 8-96
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.52e-26
Family Canonical RBD 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RD34
Sequence length 155
Comment (Magnaporthe grisea)
Sequence
MTDASRWKATLYVGGLPAAATEASLHDAFIPFGEIADVKMPKNDNPKSAETHRGFAYVEY
EDADDAKEAMDNMDQSEFFGRIIKVHAAKPPKSANEGLGSKTAVWEQEGWLAKNAVSEED
RLGGDQSAMATEPAPPAEDPMQGLEGLDVAGPRPE
Download sequence
Identical sequences G4NC92 L7HXC0 L7JIF2
XP_003717825.1.18062 148305.A4RD34 MGG_01109T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]