SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4REG2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4REG2
Domain Number 1 Region: 36-256
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.71e-82
Family Xylanase/endoglucanase 11/12 0.000000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4REG2
Sequence length 257
Comment (Magnaporthe grisea)
Sequence
MKTSAALLFLVSLASAAPMTPSPAAEAAAVLEGRQIQTLCDQYGYWSGNGYYVNNNMWGK
DSGSGSQCTYIDSSSANHVSWRSTWQWSGGQNNVKSYPYSGRTIQRGRTIASINSMPSVV
QWNYNNGNIRANVAYDLFTSTDPNRDNTHGDYELMVWLGRYGDVQPIGSQIGNANVGGRN
WQLWSGLNNGMRVYSFVTTQGAITYFNADIKQFFTYLQQSQGFPASQQYLTTFQFGTEPF
TGGQTTFQVNSFGANVQ
Download sequence
Identical sequences G4NAZ1 L7I977 L7JGN4
XP_003718337.1.18062 148305.A4REG2 MGG_00677T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]