SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4RFZ0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4RFZ0
Domain Number 1 Region: 12-141
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.51e-32
Family Calponin-homology domain, CH-domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RFZ0
Sequence length 1200
Comment (Magnaporthe grisea)
Sequence
MASVTSLDKDLRKMRLDKYTPGAAKEVREWIESTLGRSLPAGDLLEALKDGVALCNLVNL
ALPPPGIKFKTSSMPFVQMENISHFLRACQQPPLNLQQHDMFLTVDLYEAKDPAQVLQCL
GAFSRAANAANPSAFPTAIGRSRAGSILSPQSTGPVPLRGRGASNASNGSSVYGTGNRPT
LTATRTGDSGSGRWSPTKSPTSTSSWSRREHEGSTSPAWNIAQYGYMGGASQGNLGIAFG
GRRQITSAGPHVPNLAEKERMRKLREAEAEQQRVQMEEEERRRKADLEAEEQRARLEEEK
RWEEETRRQRDEEARRAEDEKRKWEEEERQWRLADEKRRKEEEEAERRLADERSRSRSKS
DARLRGQFLSQYQAEQGIKPQRTGEPGEEYRSRIEQLEKELERARQREQEYERERQGRPL
PQPSAESSSKSRTRSRSRPAAQARAPSGEQKVPPPKPMKPQTTGGSSRPLPDPKAYSNRT
DQFLSSNPAPAAQPTQPTYSRELGATAERDGEDRRRQQAQQRTKAGGWASKSLLEREMEM
ERQRQKEWEEAQEETAKAKRPADGAVDGIGGGVGGRWDVGQWSGYTGGDSQNRGQQGIGA
GRRQIVGPRPLPGSALGLTNQHGISAALCFLKTSSIIPFWQVIYCSVRIRLEAQNEQFTN
SDGPAPFSTRLEACMESPLTQQPRPEAFQQKVVRLYETLFQIQGCHYMTFAPWFWDQSTD
EKGDVLAGLDQADQVFSDFVGALEGLIRAGKDKGPFPSSDEEKPADVVGPFCLVGLLANY
NKFEFQNPYQLRLNDFVNEATIQKILRGVGNSCQLLRDQYTDIQEDHPEGWSLSYAFSMI
GLGAITSGSKPPPKPTYDAETAKKMFAALPGERAAMLLATYDFAHANKLFCFNLVTLPAE
TKGEETPFASFTSLTSYLLQHAHLTERATVYSHLNLMVFRLLIEDPTLCKRMCSEDKDAQ
ITVRLCRQRQPHLPLVRGERSAAAAVMDTMVDGINHNLRRRLDSALYALLLGILLRVISH
MSRTRTRLQYHWSELFRSLLSLVRFLTTYAADLKGLTHVDTILDHVVNLLALGLSSGEAF
LPSPAAYDDLFYKIVESGDMLVKFRDTYGLSKRSGNSIDTLVDVGEHYKRLLAENGGGSG
ANNRVTSMQVTEVIKQGYESLSIQAKEGLDSWERYREADERRLLKKVARTVVADVSAKVG
Download sequence
Identical sequences 148305.A4RFZ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]