SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4RH01 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4RH01
Domain Number 1 Region: 58-150
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.86e-24
Family Cold shock DNA-binding domain-like 0.0000933
Further Details:      
 
Domain Number 2 Region: 152-304
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.45e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.009
Further Details:      
 
Domain Number 3 Region: 7-58
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000000000471
Family ECR1 N-terminal domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RH01
Sequence length 323
Comment (Magnaporthe grisea)
Sequence
MAGGEGDIVTPGQVITEDPQWMRGHGTYTFPASPAIMSSVAGTVSRTNKLLSVRPMRARY
TPEVGDLVVGRIVEVQARRWKVDVGGVQLAALPLSAINLPGGILRKRTETDELQIRSFFA
EGDLLVAEVQQLFGDGGASLHTRSLRYGKLRNGVFAAVSGTGGGGVVRARRQVWTMEIAS
TGTSATWQDKQQKAASSQAPPSIDVVLGVNGYVWISKHVEDPTEGDGSANATGTGISNME
EAVSAKMYSSQNAPIDPVTMREIVRVRGVITALVENGVRVDEDMVERAYREAVEMARASE
GGEDDIYLGGERGAQLAAVLTGR
Download sequence
Identical sequences 148305.A4RH01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]