SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4RIC1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4RIC1
Domain Number 1 Region: 102-171,209-336
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.25e-25
Family Glycosyl hydrolases family 16 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RIC1
Sequence length 752
Comment (Magnaporthe grisea)
Sequence
MSPSLVTLATAVLACASTAAAAKAYQIEETYDTSNVNSKWDFFQSKFDTGNVLDIDPTEG
FVNYRSYNDAKSLGVLSEESGSIMMKPNFPAGITANGKGPDSVRLESKARYQQGLFIADF
SRFPKPVCGSWPAFWMFGNSWPEEGELDIYEGWNVQPVNGIALHTDHAAKVGSCHLDPQD
VNADVHTTNCDNFFTDIPRQWEGTACLVKERNGLWGNPTGGVYAIEWSSQNVSVWSWAHD
KTPADVRDGKPSPRTWGRPHFFIGDSKCDIDRVLKNQKMVLNLDFCGVTAGNEGIWGEEC
KAKTGAATCAQYVAGNPSAFSDVAFGLRSIKVYQNKEVEEPKPTTTAQSTTTTPSSTSSP
SSTNTTTSPSTTATTTASSTEASTEASTSASSTLTTTTPASTSPSATATPSSTSDCEEDE
PTGTPTPPTTKASTTAAGTTTTKEPEQSVTSTLTTTKTYTVTSCAPTVTSCSLGQVTSEV
ITTTTICPVTTTATGTATSTAAGSSTITPIGTLTPTGTATTKEPEQSVTSTLTTTKTYTI
TSCAPTVTNCPIGQVTSEVVTTTTVCPVTTTDTGSTSTKTLIGTLTTPTGAATTKAPEQS
VTSTLTTTKTYTITSCAPAVTNCPIGQVTSEVITTTTVCPPEPTSTLKTTTIHSTLSLTS
TIRIPRPSSSSVSSKSTPPFPSSSAFGGSNSTLPGSTKTTTPTLTRGTATGTGSVIKPTT
ATTPPVPIVTAGASGVEAAGLMAVGALFLFAL
Download sequence
Identical sequences G4MUZ8 L7HVP2 L7J3Z3
148305.A4RIC1 XP_003715539.1.18062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]