SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4RIP7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4RIP7
Domain Number 1 Region: 32-228
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.82e-58
Family Xylanase/endoglucanase 11/12 0.00000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RIP7
Sequence length 229
Comment (Magnaporthe grisea)
Sequence
MFPLASIITVALAVLPCAITAPTVGDPGAVSTRSLAVRQNYPWQWWTEGQGQFNCQQQGG
GRYSCSWNGQRGGGMVAGTGWGAGRKTVRYQGQYNPKGPGYLSLYGWTRNPLIEYYIVES
WDVLAPGEPWTLRGNFTSDGGNYAFYTAQRVNKPSIEGTRTFTQYFSVRSETEKKVGTVG
GAITTGNHFDAWARMGYRLGNFEQNMFMVTEAFANGTQLPSGTSTITVS
Download sequence
Identical sequences G4MVY2 L7I7Y0 L7J633
148305.A4RIP7 XP_003715657.1.18062 MGG_08401T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]