SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4RJM2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4RJM2
Domain Number 1 Region: 526-579
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000896
Family Eukaryotic type KH-domain (KH-domain type I) 0.0048
Further Details:      
 
Domain Number 2 Region: 237-319
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000833
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 
Domain Number 3 Region: 610-696
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000234
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Weak hits

Sequence:  148305.A4RJM2
Domain Number - Region: 318-387
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000656
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 
Domain Number - Region: 457-503
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00219
Family Eukaryotic type KH-domain (KH-domain type I) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RJM2
Sequence length 964
Comment (Magnaporthe grisea)
Sequence
MNKLANMRHWSERMTPASFGMSSRPNGPMPAVGPGPHQKMASTSAPQQGPSHVLDSPLHY
SFNVPLSSDLAGPDTEDILHATTDAVLRWTHPEDAPDDVPVHELPVHAQNLSNLRKLCKD
FTTSPLDIEAHVISTTPKHIKGQVTTVCLSGAAELVYHARDTILNETPLTLRCTIIDIDG
DMFLDPQTGGLKAPVTNTLDYTSSFCGVDIFLLGPKLTPLADGLNGDSELGRVIDGLHAE
LTLHQPLCGRNRKTIKLIESTTRTAIYMPPSFSSVFRYCPVNAQARDPNQIFITGEDPAH
IELAKKKMHEVLNRLRLFVKEVEIPSEKIDNILLSRMDKVQKITETFGTYISFPPLGSRK
TIVRIQGQENLHIERTARELMALVGQFYSGFWSITQTDARQHPTAHDIHTMLGDICANSD
ADISFQRLAFRITGSDDAVKAALMVLSQIKFASQSTYQIKVKIELANEHKEFVSGKKNGK
INKIMGQSSVQIMFEGFGEYNFNIDVNAQSYESMKQGLSLVEQEMPASISFHVPDQYHKR
IIGIGGQHIQRIMKKHSVFVKFSNAMDRGSYDKFRIYGRTKLTSAGGLREEDDIRVDNVI
CRTPARNAQNLELVKSEILEMVDRVDSEFTSQIVNVDRLYHRQLLTRLGEIEGLEKKWNC
KIVFPSTEQASDEVTVTGPQWQVPQCVDEFLGMVSDNHELVLARTPTLIKYLESPEFAHD
IVTKLKTQHEVEVTVHHNKDELTEEGEPTVTLLWTFTRNNAGGLRDAIEFLQNQFVTNGA
EANVIKGSIPRPKSDTFEESLPFFNSRLLQHAPTPVATDSPTKLAFSDEVARERSTLFDR
LRKPGSMSSISSFLDRRKNSSHAGANQFFKGSSNVSKSSLISIESTRSFNADRNPWNDSG
VNLADDEPWPARPFGNGMDHKLTVPQPGDMTPRHHTRPSGDSGRPSTSHSTNSGYPGPVG
PFQR
Download sequence
Identical sequences M9VUI0
MGG_01781T0 148305.A4RJM2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]