SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4RJP0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  148305.A4RJP0
Domain Number - Region: 153-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0712
Family Laminin G-like module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RJP0
Sequence length 278
Comment (Magnaporthe grisea)
Sequence
MGAWKILTTLMLLGLGGQVNAKPSFKNNGTLDGWDGQSLEKGTQGTITESTSSVFNGDTS
LKMTQTYLPDYTGRYHAEVYKKDGYVPGDSKFYGFAFRLEEKWQFDKQSFNLAQFIADFT
GDSKGCDDWMPSTMVWMVGDQLKTRTKTGDICNQKTTSFDAGKVKAGFWHTVVLEAAWHA
DDKGLLRMWLDGNPVLNKTGVPTTIEDTKKRAFSFRVGLYANGWHDDKKLVGNQKTRQVW
YDEIAMGDTYEDVEPRPDKNAVQMTPAAAKRDGGVVYF
Download sequence
Identical sequences G4MVP2 L7IDD1 L7J6U0
148305.A4RJP0 XP_003714765.1.18062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]