SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4RK13 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4RK13
Domain Number 1 Region: 44-148
Classification Level Classification E-value
Superfamily Histone-fold 2.55e-41
Family TBP-associated factors, TAFs 0.0000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RK13
Sequence length 194
Comment (Magnaporthe grisea)
Sequence
MSDSPQSNPKEIEGAHTPDEEAQMNDPQDPQSAGLGYEFEVKEQDRWLPIANVARIMKNA
LPDNAKIAKEAKECMQECVSEFISFITSEASEKCHQEKRKTVNGEDILFAMTSLGFENYS
EALKIYLAKYREGQQNRPSSQGYGAPPGAAPGTNATAGFPGGELGQQGTEAPGDASGYLY
STQPGHNGATAGEY
Download sequence
Identical sequences 148305.A4RK13

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]