SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4RLD7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  148305.A4RLD7
Domain Number - Region: 302-395
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00038
Family Galectin (animal S-lectin) 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RLD7
Sequence length 454
Comment (Magnaporthe grisea)
Sequence
MCFGSKSQRDSSAVGPKPAASVPQQNSASVPPASKTSYPAPQQQQQQPQQQPEEYAPPPG
PPPGSSQSPRSAPPVVDDDFAPPPGPPPSHTPQPPAATSDDFAPPPGPPPSHTPQPPAAT
SDDYAPPPGPPPGAAAGNTTSTTEYALPLGPPPDYSNPAAPAQQQQQQQQQQPQHDWQAA
VPDTSLFPPPPDIFSHHEFSPANNASEFEMEAGEAWCAAHPLSPPLALDPPSAAAHEAHN
PRLMQPANFRGLLRWLGQGHWELRTADRRCTDATVLAYPPLYCAGRQQQPPQPSAAPRKP
TVVYYEVQIRSDSRADETSLAVGFAALPYPPFRLPGWHRASLAVHGDDGHRYTNDLAGGC
SFTRPFRRGERIGLGMKFAGGPGGRVVIFFTRGGKIDGSWDLHEETDATEVGGVQGLEGW
HDISAAIGTFDFVSLEVFFEPTKWLYKGGGQDVM
Download sequence
Identical sequences G4MXI1 L7I2M8 L7JBC6
XP_003714119.1.18062 MGG_01220T0 148305.A4RLD7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]