SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4RM53 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4RM53
Domain Number 1 Region: 83-315
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.06e-31
Family Glycosyl hydrolases family 16 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RM53
Sequence length 403
Comment (Magnaporthe grisea)
Sequence
MNLRTVTGSASSILLILSSIHVAVADLPLVSDSKCGCYVTNGSNSAFFTSHRFYDFRSLS
QYVGSGIPDAPSSSPQAASNASITSGYFNTSAFTDDWSIMTWNNSASVGGDAAILMVNSP
TNLFIQKNNDTDADSDTYLTMRTARNEDFQSASEIESNSNRYRFVSMRMLARTTGAPGAC
TALFTYRSAKDYADVQEADIEVLTKDPTDKIMYTNQPSYVKVGNDTQNIPESNINGTAPV
DWTQWSVHRLDWTPLRTTWYVDGRQVASISFQTPRDASRINLNSWSDGGDWTGLMDVGKE
ARMQIKWLEMVFNQTSSGTSRMRPRDHTGNSGRGSGNGNSGGASDSGSTEGLSDGKCRTV
CSIDDTDQRGMAAVVADGGAATLKLAAWIPISVALVTMAASMF
Download sequence
Identical sequences G4MUQ9 L7IFX7 L7JMK2
148305.A4RM53 XP_003713839.1.18062 MGG_08823T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]