SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.Q5G578 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.Q5G578
Domain Number 1 Region: 18-122
Classification Level Classification E-value
Superfamily Histone-fold 1.65e-46
Family Nucleosome core histones 0.00000997
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.Q5G578
Sequence length 136
Comment (Magnaporthe grisea)
Sequence
MTGGGKSGGKASGSKNAQSRSSKAGLAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEY
LAAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLP
KKTGKTAGGKNASQEM
Download sequence
Identical sequences L7HZV6 L7IUS0 P0CT12
XP_003716333.1.18062 148305.Q5G578 MGG_03577T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]