SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.Q5G5A1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.Q5G5A1
Domain Number 1 Region: 62-298
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-47
Family Glycosyl hydrolases family 16 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.Q5G5A1
Sequence length 439
Comment (Magnaporthe grisea)
Sequence
MKSTILSIGAAALLSAQSVLAADGLKCSLDKHCPKEAPCCGLYGDCGTGAFCLGGCDPRM
SFSLDSCVPEPTCQSKKFTFNSKDRIQDVSEYLGDASKADWVVTGEPLFSNGNLLLTMPP
RSVGTVLSSTHYMWYGNVKAKMKTSRGRGVVTAFILFSDVKDEIDYEWVGVDLETTQTNY
YFQGIPKYDQSGNITGTSNTFENYHEYEINWTPDEITWLVDGKKGRTKKRSETWNATAQQ
WDFPQTPSRVQFSIWPGGADTNPKGTVDWAGGAINWVDHPDLKDPGYYYAMVSEVEIKCW
DGSNGVGTNKGKTYYYNSARGTNDTVVDSDKNGILSSLQATGLDMNKGGDKSKPDASTTG
VDIPSVPGGSGVGPGQAGTNQGGGQAAQPPDNCFSDNFVQKCGTGGSSKNAGGRVETPSI
LSGSSAFAVVVAFAGLVML
Download sequence
Identical sequences G4NC59 L7HZB0 L7JKS8 Q5G5A1
MGG_01134T0 XP_003717792.1.18062 148305.Q5G5A1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]