SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 150340.VEA_002747 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  150340.VEA_002747
Domain Number 1 Region: 142-280
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 1.7e-46
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000228
Further Details:      
 
Domain Number 2 Region: 56-138
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 9.59e-19
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000887
Further Details:      
 
Domain Number 3 Region: 4-54
Classification Level Classification E-value
Superfamily UBA-like 1.63e-17
Family TS-N domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 150340.VEA_002747
Sequence length 281
Comment (Vibrio Ex25)
Sequence
MATVTAALVKELRERTGAGMMECKKALVEANADIELAIENMRKSGAAKAAKKAGNVAAEG
AIIIKEENGVAVLLEVNCQTDFVAKDGNFTAFAEEVAAAALASKATVEELQAQFEDARVA
LVAKIGENITIRRVEYVQGTAIASYRHGEKIGVVVAGEGDAETLKHVAMHVAASKPEFVN
PEDVPADVVEKEKAVQVEIAMNEGKPAEIAEKMVVGRMKKFTGEISLTGQAFIMEPKKTV
GEMLKEKGASVSTFVRLEVGEGIEKKEEMSFAEEVAAAQKG
Download sequence
Identical sequences A0A034TRS3 A0A0M9C1K0 A0A0T7EBS0 A0A2J6IPT4
gi|262393520|ref|YP_003285374.1| WP_012841502.1.10903 WP_012841502.1.18397 WP_012841502.1.25443 WP_012841502.1.3237 WP_012841502.1.36366 WP_012841502.1.43605 WP_012841502.1.98725 150340.VEA_002747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]