SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G03540.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G03540.1
Domain Number 1 Region: 302-618
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.03e-71
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 54-251
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.66e-45
Family Legume lectins 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G03540.1
Sequence length 681
Comment (Brachypodium distachyon)
Sequence
MPPPSTSNAQHSPHAMLLLLRRRRPIDDLSTTAAAISLLLLLLVAVQAAAVVEEFVYPGF
LGAGENVTTTGGAVVTASGLLQLTNFTKEEFGHGFHGTPIRFRDAATGLLVSFSTTFVFA
IFPRYPDALGHGLALAFAPSPAIPGAVTGKYLGLYNTSNSLGAVWIEYDAATALLEVTVA
PAGEPRPAVALVSYSLDVSSSLVAHDGGTYVGFSAANGAASSTHYVLGWSFRIGGGPAPE
LDLSALPKLPKQPRPSKAPPPLTVALLVVLAVVVALVLAVAATVLVRRRRRRFADAEEEE
WESEYGPHRISYRDLHAATDGFRHVIGAGGFGQVYRGVLPAGSGSTEIAVKKVYPQGHGS
SQQGLREFISEIASMSRLRHRNLVRLLGYCRRRGGDGELLLVYDYMPNGSLDRHLFVPSS
GNSKRHPLSWEQRAKIIHGVAAGLLYLHEGWEQVVVHRDVKSSNVLLDGAMNAKLSDFGL
ARLYDRGGGSGEQRTTSIVGTPGYIAPEMSKTGRATAATDVFAFGAFLLEVACGRPPNAP
GAGAGDNDDDDNYPPGLVDLVAGRWKAGEIKAARDPRMAVAGEQEEGEVETVLKLGVLCS
HPDPRRRPGMRRVVQVLEGAAPAPETMPEDLGAGLFGYGGEAFDEFVDTGFTASSEGTTA
TITRPSSSRSPEEKQQLITAD
Download sequence
Identical sequences 15368.BRADI1G03540.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]