SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G04960.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G04960.1
Domain Number 1 Region: 218-276
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000777
Family Galectin (animal S-lectin) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G04960.1
Sequence length 553
Comment (Brachypodium distachyon)
Sequence
MRRPPAAAAGASSCRRRAVQGFVALAFLAYALLVLSLGSRGAAHASLPGGKGSASSRPLH
LDGDGERGAPARPSKRAHRETLEAAPGIVSGLDLRRLNSSRSGSLRKVAAEAAAAGARVF
SELQALAGTLSASSDEEERSKCPHSIVLTGDEFRARGRAWGTPLRCEGWMSRADEETVDG
MAKCEKWIQDEGSKESMTSWWLNRLIGRTKKVSVDWPYPFVEDRLFVLTLTAGLEGYHVN
VDGRHVTSFPYRIGFVLEDATGLSLNGNLDVQSVFAGTLPTTHPSFAPQKHLEMLPVWQA
PPLPDGPVEIFVGILSAGNHFAERMAVRKTWMSAAQKSSNVVARFFVALNGRKEVNMELK
KEAEFFGDIVIVPFMDSYDLVVLKTVAICEYGVRISARYIMKCDDDTFVRLESVMAEVKR
IPSSKSLYIGNMNYRHYPLRNGKWAVTYEEWPEEDYPTYANGPGYVISSDIADSIVSEFT
NHKLRLFKMEDVSMGMWVERFNKTRPVEYVHSVKFCQFGCIDDYYTAHYQSPRQMLCLWD
KLQAGRPRCCNMR
Download sequence
Identical sequences 15368.BRADI1G04960.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]