SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G07210.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  15368.BRADI1G07210.1
Domain Number - Region: 13-48
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000392
Family Ribosomal protein S14 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G07210.1
Sequence length 56
Comment (Brachypodium distachyon)
Sequence
MGHSNVWNSHPKNYGPGSRVCRVCGNSHGLIRKYGLMCCRQCFRSNAKDIGFIKYR
Download sequence
Identical sequences A0A1D5ZKM9 F2CVW9 I1GMU2
15368.BRADI1G07210.1 15368.BRADI4G06620.1 15368.BRADI4G12610.1 EG:BRADI1G07210.1 EG:BRADI4G06620.3 EG:BRADI4G12610.1 MLOC_18775.1 MLOC_55124.1 MLOC_77439.2 XP_014751900.1.954 XP_014757424.1.954 XP_014757523.1.954 XP_020158228.1.58150 XP_020168291.1.58150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]