SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G26170.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G26170.1
Domain Number 1 Region: 289-555
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.89e-31
Family Calponin-homology domain, CH-domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1143-1283
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000307
Family Armadillo repeat 0.02
Further Details:      
 
Domain Number 3 Region: 956-1043
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000478
Family Motor proteins 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G26170.1
Sequence length 1340
Comment (Brachypodium distachyon)
Sequence
MNRCELTDPPFRDVSNLRTQKPNPKSPVPLLFTASKTALPGPTPTPLGRRRPRTGAGTPT
PVGSRRPLAGAATPLARRLRALELDQSRSARRAECGRERALRAFAASASSWLSLLLRDPS
ACGCSPAASPTATRAPVAGKRDSLDGARAPGSSPKRHRGRDRCGERRKAMTPAMEVVLRD
SLREVCSLDDVKERMDKYMSTDAREEVLVMMCRICKKKLAHEGEPDRLASDGKNASREGK
MFRSSRKPRSHPQQLLLILLIQTDRWGKNIDGSRLKMKAHCPIVTDLRLKENAIRIFMCY
NPEWLRIGLHIVLGGDCLLQNGLRKQDKEVPFLKLILEKQLFGQLVAPKTSAQNKLVERL
HRTESLGEAMHGEGDLLMHLSSMGYILNYQQLALSEYDFTIGNLFEDLLDGIILCRVVHL
LLSDTSIILKVIAPSDTHKKKLHNCTMAIQYIKKAGVPISDADGVTISAEDITNGDKELI
LSLLWNIFIHMQLPLLANKTSLARELSRLKAPTVEQPVSETKSHMGLLYDWFQVVCEKYD
INVETSSKIDRRALNYFINYYLNIGIQRCPPKETFSDCRKELFGYEQETFTDTSSCPTNK
MEKVLGDFLQDSPASGILASDILFDEKGAVILIAFLCSHLTSDKRLEQLRNLTNARLDHQ
SLENKVSAMIISLGKNDVKYQSPQRDNTDNSCTSQERAATIIQTQVREIIAKNKYLKIKK
SIAILQGAMRAWSSVIMKSKCKCQTAAFSTRQEAHGNFNRYFTFMLERHRFVRMRRSAIV
IQQAVRIWIRGRKRLENIEHFESHEFFKARASSKTDCVCKELCDGENETIPCKDVRTSTA
SAANPQCLDETDCIDATPLQLGDKHINHVTPIIQLCNCWHDSLASPSPHQSMVESVSINS
LSHHLFKVETASIASATKLVHDEDDMDCGGNIFSGASFQNEQPVSAQVDFLLCKDVMAAR
KIQFAYRRYVHERYSRMSAAIKIQSHWRGFTMRMCFTKQVEAIIAIQSVTRHNLCHWAFQ
QNRGSTIVIQRFARGFLARKRLLGSSLQAYKGTFALDGSQHERYHQRIELKIVVYSILRL
QRWWREVLLHRSIRRSVISIQSSAFIKAYHVRKASKKEVADIRSRIQKASSQIDDGMRLL
NRLIAALSQISDCRSISSIRQTCTTLSFATELSEKCCETLVGAGAVDILLKQIPKLNRGI
PDQEVLKQVLITLRNIARFPNLRPVLANTPQLVNIIFQELLRNEEDGFFIACGILKNLCQ
SKEGHEITAGVLQHRIKRLCSVVEDLEKKVEHDKRNGRTGAKKEDSARRRLGEAASLYHL
LTDDFYDLVNRKARSNIRRH
Download sequence
Identical sequences I1GTY1
EG:BRADI1G26170.1 15368.BRADI1G26170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]