SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G32050.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  15368.BRADI1G32050.1
Domain Number - Region: 25-60
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00032
Family B-box zinc-binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G32050.1
Sequence length 258
Comment (Brachypodium distachyon)
Sequence
MEMGMMNNRPGWVGGLVEESFFVGCEAHESRKKNEKNIFCLACRTSICPHCAPAHRHHPP
LLQVRRYVYNDVVRLDDLEKLIDCSFVQPYTINSAKVIFLKPRPQSRPFKGSGNICLTCD
RILQEPFHFCCLSCKVDHVMMQGGDLSNILYMSGEPDVACFPRFEDLRVGGGGSGSSAYL
HVDNGGQVTPNSILEDTLAMHHHQYHHYGINGGGSGSSTGSGAPKKKKGGGGGGGFFPKI
VLSLNNRRKGEPHRSPFA
Download sequence
Identical sequences I1GVY3
15368.BRADI1G32050.1 EG:BRADI1G32050.1 XP_003563366.2.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]