SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G38040.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G38040.1
Domain Number 1 Region: 612-973
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.77e-115
Family Motor proteins 0.000000911
Further Details:      
 
Domain Number 2 Region: 33-144
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000156
Family Calponin-homology domain, CH-domain 0.0053
Further Details:      
 
Weak hits

Sequence:  15368.BRADI1G38040.1
Domain Number - Region: 419-485,662-706
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0398
Family Motor proteins 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G38040.1
Sequence length 1218
Comment (Brachypodium distachyon)
Sequence
MAIVHGVCLCRVKHDNGWSGQGMEAVGGTSASVAYEQRRSEAVAWLRALLRRSSLPLPPP
RASDEELRAALSDGALLCAALRRLTRPASSGDEGGAAAECDVGRFLTTAERMGLPSFTAS
DLEKGSMSAVVACILELRDQFVSRADEGWISSLSENGSVNNMEFPRRENGQATQNSEARD
ESQQMEMLLQKVYKSPAMSEPSSPISSISRHAGSNFHEVFQLRLGGYSDLPSSRISDMMK
STSLNNAPTQSLLSVVNGILDETIERNNGEIPYQNNLMKAREEKYRSRIRVLEALASGTS
GQNQIQVSSSATNGKAHIGADPAGQMKMEKDKFEEKRRLVEDDLTKVIKDTEDVTRLTKD
KEEMARLLTDKEDIIRLMKEKEEMVRLIKEKEHMVIMKNGKDENRKADEHIAKPIMYKDE
LIRLTKEKENTKYTISKLNLELEAMKSSYEESHSLLESKKEDVLTLLKDKEISGNVISQL
RQELAIARVSHERHIQELKTMALQENMEFEQRIKEVELMLEDSTKRGRYLEELLESRIQT
WEQKETMLQRFDLRLSSISIRNETQNCQKRWSEELSCLGKRLKVLTNTAEKYHATLEENR
KLFNEVQELKGNIRVYCRIRPFLPREARKSSTIEFIGDNGELSLANPAKVGKEGSKLFKF
NKVLGPIASQDEVFKDIQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPEYATEKELGVN
FRALNDLFIISHNRRDTIMYEVNVQMIEIYNEQIHDLLGSNGILNASKLHGLAVPDATMR
PVNSTADVIELMRTGLENRAVGATALNERSSRSHSVVTVHIQGVDLKSGATLHGALHLVD
LAGSERVDRSAVTGDRLKEAQHINKSLSALGDVIFSLSQKTAHIPYRNSKLTQVLQSSLG
GHAKTLMFVQINPEVSSFSETLSTLRFAERVSGVELGAAKANKEGKDIREFKEQLSLLKD
KIAKKDEEINQLQTHSPRIRTPKHADSLLKHSSSSPGISSLGSKIRHRRTASSGKAMSIR
ADSDADNFSEISDMHSEAGSMQSVDDMQQQRGIMVVSKHSEGEMGQHLADPELAGFGYAD
SEERLSDISDSGLSMGTETDGSVSSVVEFALFPEQEKICSTQKEQEKAHNAPKDQLYKVA
TRIQKTTTPKTTPSSSLWPKSRDSSPRSPEVSIQGNQFYGRTVLPFFIFTSTKDSIGGGG
PSLSDFIACFVSHVDLAH
Download sequence
Identical sequences I1GY22
15368.BRADI1G38040.1 EG:BRADI1G38040.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]