SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G56280.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G56280.1
Domain Number 1 Region: 427-624
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.23e-46
Family Ribonuclease PH domain 1-like 0.0000318
Further Details:      
 
Domain Number 2 Region: 90-227
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.24e-40
Family Ribonuclease PH domain 1-like 0.0000523
Further Details:      
 
Domain Number 3 Region: 231-314
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.51e-23
Family Ribonuclease PH domain 2-like 0.0015
Further Details:      
 
Domain Number 4 Region: 582-685
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.65e-22
Family Ribonuclease PH domain 2-like 0.00018
Further Details:      
 
Domain Number 5 Region: 753-834
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.46e-16
Family Cold shock DNA-binding domain-like 0.0018
Further Details:      
 
Domain Number 6 Region: 680-764
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000379
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Weak hits

Sequence:  15368.BRADI1G56280.1
Domain Number - Region: 322-381
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000194
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G56280.1
Sequence length 900
Comment (Brachypodium distachyon)
Sequence
MLASPATLHHLLLPPPPHLAFSLPHPAPTLHALLPLSRLPPPRVAAFAHASYSRSRLRRR
DARPRVVASVREEAPAAEEASSSGPTKFSVKIPVGDRHILVETGHIGRQASASVMVTDGE
TIIYCSVCMADTPSDPSDFFPMSVHYQERLSAAGRTSGGFFKREGRAKDHEVLVCRLIDR
PLRPTMPKGFYYETQILAWVFSYDGIHSPDCLAVTAAGIAMALSEVPNKQTIAGVRIGMI
NDQFVINPTTEEMKDSELDLMMAGTDSAILMIEGFCDFLTEEKLLQAVETGQVAIREICK
AIDVLVQTCGKKKMVEAINLPPPELYRHVEDISGDELVKALQIKQKIPRRKALSALEENV
ITILSEQGYVSKDESSGVIENLADIVEEEDEDEVIVDGEVDEGEVHIKPVSRKPPRQLFS
EVDVKLVFKEVSSKFLRRRIVQGGKRSDGRSPCELRPINSQCGLLPRAHGSALFTRGETQ
ALAVVTLGDYQMAQRIDTLVDTEESKSFYLQYAFPPSSVGEVGRTGAPNRREIGHGMLAE
RALEPILPSEGDFPYTIRVESTITESNGSSSMASVCGGCLALQDAGVPIKFPVAGIAMGL
VLDTQEFGGDGTPLILSDITGSEDASGDMDFKVAGNEHGISAFQMDIKVVGITLPVMERA
LLQARDGRKHILNEMSKCSPPPSKALSPHAPVIHVMKVKPNKVNLIIGSGGRTIKSILEE
TGVYAIDARDDGTVKITARDMESLEKSKTIIANLTMVPKVGEIFRNCEIKTIAPYGAFVE
IAPGREGLCHISELSSSWLAKAEDAYKVGDRIDVKLIEINDKGQLRLSSKALLPDADQEP
SSKQQTRGSAKEKVVYKDDIIKVTTRRSRRKKDVEPSAAENATGKTLENSTAASTNDLAS
Download sequence
Identical sequences I1H3D7
EG:BRADI1G56280.1 XP_003557535.1.954 15368.BRADI1G56280.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]