SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G57720.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G57720.1
Domain Number 1 Region: 337-649
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.01e-77
Family Protein kinases, catalytic subunit 0.0000896
Further Details:      
 
Domain Number 2 Region: 38-291
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-72
Family Legume lectins 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G57720.1
Sequence length 672
Comment (Brachypodium distachyon)
Sequence
MTYELPHPSYMKFFFLCFLLSFSLDLAFFSTTSDNQLLYLGFTGTNLTLDGTTTVTSNGL
LELTDGSIYSKGHAFYPIPLHFRKSSNGIIQSFSVAFVFAIRSRYPIISQHGMAFIIAPR
TNFSDALGSQYLGFMNSLDNGNLSNHIFAIELDTIQNLEFQDINDNHVGININNLRSMQS
NPAGYYDDRSSSFQNMSLKSGDAMQMWVDYNGEDKKISVTMASLQMGKPTRPLISANCDL
STVLQEPSYMGFSSSTGTVGSRHYVLGWSFSMSKTAPVIDIAKLPRLPRQGPTHQLRILE
IILPIASAIFVIVVGVVAIFLVRRRLKYAELKEDWEIEFGPHRFSYKDLYHATEGFKNKF
LLGAGGFGKVYKGILPSSRLEVAVKRVSHESSQGIKEFVAEIISIGRIRHRNLVPLLGYC
RRKGELLLVYDHMLNGSLDKYLYCHEQKPTLNWPQRYWIIKGIASGLLYLHEKWEKVIIH
RDIKASNVLLDSGMNGRLGDFGLARLYDHGTDLQTTHVVGTMGYLAPELVSTGKASPLTD
VFAFGMFLLEITCGQRPVNSNAHGNQPILVDCVLEHWRKGSLTEAVDTRLQGNYNVDEAC
LMLKLGLLCSHPFTNVRPNMQQIVRYLDGDLPLPELTHTDMSFSMLSLMQDEEFDPYALT
SIGTISGVSGGR
Download sequence
Identical sequences I1H3U0
15368.BRADI1G57720.1 EG:BRADI1G57720.1 XP_014751876.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]