SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G61230.2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G61230.2
Domain Number 1 Region: 131-214
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000242
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 2 Region: 358-439
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000285
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 3 Region: 32-93
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000414
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 4 Region: 269-330
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000543
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G61230.2
Sequence length 538
Comment (Brachypodium distachyon)
Sequence
MVGPGHRNSHGKRYSDYAENGGGKRRNPGDDTYAPCPDDTVYRYLCASRKIGSIIGRGGE
IAKQLRTDTQAKIRIGESVPGCDERVITIFSSSRETNTVEDTEDKVCPAQDALFRVHEKL
ITDDGPGDEENEEGLAQVIVRLLVPSDQIGCIIGKGGHIIQGIRSDTGSHIRVLSTEHLP
ACAISGDELLQISGDPLVVRKALLQVSSRLHDNPSRSQHLLASSLTQPYPVGSRHGSSST
TPVVGIAPMVNPYGGYKGDMVGDWPSIYQPRREESSAKEFSLRLLCAASDVGGVIGKGGG
IIKQIRQESGAFIKVDSSSAEDDCIITVSAKEFFEDPISPTIDATVRLQPRCSEKTDPES
GEPSYTTRLLVSTSRIGCLIGKGGSIITEIRRTSRANIRILSKENVPKVASEDEEMVQIS
GDLDVAKHALVQITTRLKANFFEREGSLSGFQPVIPYHPLPASVADESKYLGRDAKLGHD
YPYSGGYRASEDMLPVDSYANYGSSQVSGGRYGTYSGRSGSSGLSGPSYLSSGKRYGY
Download sequence
Identical sequences I1H521
EG:BRADI1G61230.2 XP_003557874.1.954 XP_010228569.1.954 15368.BRADI1G61230.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]