SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G76070.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G76070.1
Domain Number 1 Region: 84-212
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.52e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.00041
Further Details:      
 
Domain Number 2 Region: 5-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000687
Family Glutathione S-transferase (GST), N-terminal domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G76070.1
Sequence length 223
Comment (Brachypodium distachyon)
Sequence
MAAGLQVFGQPASTDVARVLTCLFEKNLEFELVRIDTFKRQHKLPEFIKLRDPSGQVTFK
HGNKTLVDPRAICRYLCTQFPNEGNRNLYGTGSLERASIEQWLQAEAQNFNPPSSALVFH
LAFAPHLDIPQDYAAIAENEKKLQQVLNVYDEILSKNEYLAGDEFTLADLSHLPDSQYIV
DSDRGRKLFTSRKNVARWFDQISRREAWEQVVKMQMEHPGAFE
Download sequence
Identical sequences I1HA12
15368.BRADI1G76070.1 XP_003558872.1.954 EG:BRADI1G76070.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]