SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI2G05880.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI2G05880.1
Domain Number 1 Region: 25-117
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000134
Family Thioltransferase 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI2G05880.1
Sequence length 121
Comment (Brachypodium distachyon)
Sequence
MQAVAGVRRGLTIDPAGEEEPPAARFGRLVREIPVVVFARRGCYMAHVMRSLLAAVGAHA
TVVELDGAAEELAAAEGGAAGVPALFVGGAPVGGLEGLMGLHLSGRLVPRLQEAGAIAAY
P
Download sequence
Identical sequences I1HCY1
XP_010230580.1.954 EG:BRADI2G05880.1 15368.BRADI2G05880.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]