SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI2G07800.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI2G07800.1
Domain Number 1 Region: 534-611
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000263
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 2 Region: 702-873
Classification Level Classification E-value
Superfamily LigT-like 0.000000575
Family 2'-5' RNA ligase LigT 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI2G07800.1
Sequence length 880
Comment (Brachypodium distachyon)
Sequence
MEDECLDHDHQQQQQQQEEEEKSNNGQLTQRLEGIEEEGGPAETWAPPPAAKTVRAPETP
TETMEFLARSWSLSAAEISKALKVLSSKGAAVCDDDIPDAAVPCAALGKEQRPPPETSPP
FSPRAATSATMDAQLLRAGGRGGGKTTTMGAWMKEQKEKKRAEARSRNAQAYAATSVAGV
AAAVAALVAGAVFSSSSSPPSDPPNPAANNAKTAAAIASAAALVASHCVEMAQAIGASHE
QIVASVGSAVNAQTSGDVMALTAGAATALRGAAMLRARLHREIQGAALPGGDGGRSAASE
RDVSPLVFVSRGGELLKRTRQGILHWKLVTVYIDTNFQVIMKMKSAHMAGTFIKTKKCVV
LDVRAEVAAWAGREVDDGMGLARRGYFGVRTEERVIEFECRSKREQRRFSRLARRPLCAA
GSPLLRYLQGSVGQNNLHSFAMERAQGVSGNAAKHRKTNSPVQRWRPVSTEASPQKADLD
EISSSGMKQVLETSVTDSENLVSDETTTNVVIEVTTNNASSSENSSTFGSSGTKVVIKDT
VEVDVPLMRFLKGKGGSIQKQIEQETGVKIIFPSSKEETLVVLEGQNAESIRKASERIAK
VLEEAVQSPMLDYSHFVSLPLAIHPDLVEKLNNFQRSILGASSFNVDSDKDESLSEGSVD
ETDEVESPSVSTKLLVQEEKSIMVKRDNRGSQPEFGIDKSIFIKPKTFHLTVLMLKLWNK
DRLAQASDVLQSISSQVNEALENRPVSIQLRGLTCMKGSPARARVVYAPVLEVGGEGRLV
HACKVITEAFVKSGLVLERDARQELRLHATIMNVRHRKSKKRDRRNDSIDARNIFRQYGE
HEWGEYPIPAVHLSQRFKFDESGYYHCCSSIPLPEATQTK
Download sequence
Identical sequences I1HDK2
15368.BRADI2G07800.1 EG:BRADI2G07800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]