SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI2G08090.2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI2G08090.2
Domain Number 1 Region: 184-262
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.03e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 2 Region: 271-356
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000438
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 3 Region: 451-521
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000453
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 4 Region: 26-122
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000112
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI2G08090.2
Sequence length 527
Comment (Brachypodium distachyon)
Sequence
MNAILHVFDRIFITEIGNESGDPSGERTPVSFRLLVLDSQVGWLLGNRGSVIKQMSADSG
CEIRVSKEKLPLCALLKDELCQITGELDSVRKGLNAVAQVLLTHPPRESDVLPSGLSSHA
FNRSDALPPGMQPNFSLPFQGPSHARGPFDSIDPRPNIPPFPTFPDQRSNIPPFPAFPDA
LMHSHASVPPEPLTFRLLCSSDKVGSIIGKGGNNIKTIQKDTGCEIKILETVPKSEDRVI
VISGPAHPGDGISPAQNAILHVQRRITPPTANNKEGAAISRLIVSPNQVGCLLGKGGSII
AEMRKLSKAHIVVLSKDKIPKGVQESDEVVQITGDSEAIQEALMQITARLRNHLFRDRMA
AMGPNMQPPFGSLDPQFGAFAGSHESTSPRIYPNASQFHKDFMGRPLDEMPAPWNAKGMR
DVGDPMSISGMPGMPHRGIGGFSGAGHSSMPNITRDIMVPRFVIPALCGHDGGCLNMIRE
FSGAMITFTEPIADAADTPFMISGTLDQMHAARSLIQAFVLSEPPAP
Download sequence
Identical sequences 15368.BRADI2G08090.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]